PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30076.m004623
Common NameLOC8267311, RCOM_1346340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WRKY
Protein Properties Length: 317aa    MW: 35187.4 Da    PI: 6.8832
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30076.m004623genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.92.5e-34168225259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h+
  30076.m004623 168 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFSDPSIVVTTYEGQHTHP 225
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.1E-1101317IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.805.4E-35152227IPR003657WRKY domain
SuperFamilySSF1182901.31E-29159227IPR003657WRKY domain
PROSITE profilePS5081131.938162227IPR003657WRKY domain
SMARTSM007741.1E-40167226IPR003657WRKY domain
PfamPF031068.3E-27168225IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEGTEAVKIE NIVGSSPPPP TTAFPDLLYG SYPLQSVFDN FYGGDKSSLG FLELLGVQDF  60
TSPSVFDTLQ LPSTTMQQPP ATNNSPAVVV TKMESPEVFN QPATPNSSSI SSASSEALND  120
EAPIKAVDNE EEEQQKTKKE LKPKKTNHKR QREPRFAFMT KSEVDHLEDG YRWRKYGQKA  180
VKNSPFPRSY YRCTTASCNV KKRVERSFSD PSIVVTTYEG QHTHPSPVMP RPSFVGAASE  240
SGFSATNFAM PMQRRLSLYQ QPQQPFFNSF SPLGFGYNST TNASLLHEKR FCTAPGAALL  300
EDHGLLQDIV PSHMLKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-271602271077Probable WRKY transcription factor 4
2lex_A5e-271602271077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9146520.0JQ914652.1 Hevea brasiliensis WRKY super family protein (WRKY8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515251.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229006e-73WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLB9RNB20.0B9RNB2_RICCO; WRKY transcription factor, putative
STRINGPOPTR_0002s19390.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-66WRKY DNA-binding protein 23